PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01110.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 467aa    MW: 51987.5 Da    PI: 5.1966
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01110.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.77.9e-52271541128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yL++kv gk++++ ++++e+d+yk+eP++L   ++vk+++ ewyfFs+ dkky +g+r nrat +gyWk
  Sme2.5_01110.1_g00002.1  27 LAPGFRFHPTDEELVRYYLRRKVCGKPFRF-QAVTEIDVYKCEPSELSeySSVKTRDMEWYFFSPVDKKYGNGSRLNRATGQGYWK 111
                              579*************************99.88**************84348888999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+ v++ k e++g+kktLvf++grap+g++t+Wvmheyrl
  Sme2.5_01110.1_g00002.1 112 ATGKDRVVTH-KAEAIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 154
                              *********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6124177IPR003441NAC domain
PROSITE profilePS5100556.63227177IPR003441NAC domain
PfamPF023652.3E-2829154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MEQEGSMVVA EAVTVASPAP APAPASLAPG FRFHPTDEEL VRYYLRRKVC GKPFRFQAVT  60
EIDVYKCEPS ELSEYSSVKT RDMEWYFFSP VDKKYGNGSR LNRATGQGYW KATGKDRVVT  120
HKAEAIGMKK TLVFHSGRAP DGKRTNWVMH EYRLADKELG KAGIVQDSFV LCRIFQKSGL  180
GPPTGDRYAP FIEEEWDDDS AALPAGETDD DAVNVVEARA ESNDLGQSFV SLAVNLLAVL  240
LVVDNSVTSC FTVDVTNKKE SEITNQNRKK FQIGDRETEN GEWDYNMGNR TLTNKVSVQD  300
AQHKTALHGE NVVELQSLPF GCKRERSEEP ELCLSQSKKS KHDVASSSRA NGSEDSTITS  360
QDMVNVMTTK DYPVALLGFP LVESFGPKES QPSNPPTFDS ANLEKSIPPG YLKFINNLET  420
GILNISMERE TLKIEVMRAQ AMINVLQSRI DLLTKENEDM RRLICGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-492617719168NAC domain-containing protein 19
3swp_C2e-492617719168NAC domain-containing protein 19
3swp_B2e-492617719168NAC domain-containing protein 19
3swp_A2e-492617719168NAC domain-containing protein 19
3swm_D2e-492617719168NAC domain-containing protein 19
3swm_C2e-492617719168NAC domain-containing protein 19
3swm_B2e-492617719168NAC domain-containing protein 19
3swm_A2e-492617719168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00342DAPTransfer from AT3G10480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0146260.0BT014626.1 Lycopersicon esculentum clone 134129R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016550128.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLS4T6W40.0S4T6W4_CAPAN; NAC domain class transcription factor
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.11e-88NAC domain containing protein 52